5 ago 2008

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch


Llanfairpwllgwyngyllgogery chwyrndrobwllllantysiliogogogoch is the longest named railway station in the world. Llanfairpwllgwyngyllgo gerychwyrndrobwllllantysiliogogogoch is an actual town in Wales.Llanfairpwllgwyngyllgogerych wyrndrobwllllantysiliogogogoch, translated in English means "The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".
The locals hardly use this long word, instead call it as Llanfair.
Also, this town boasts the longest single word (without the hyphens) .com domain name in the world. The maximum allowed characters as a .com domain name is 67 characters in length. So this, Llanfairpwllgwyngyllgogery chwyrndrobwllllantysiliogogogoch.com has a few more characters to spare (58 characters in length). Llanfairpwllgwyngyllgogery chwyrndrobwllllantysiliogogogoch.com is officially in the Guinness Book of World Records and was registered by Internetters on 21st October 1999.

There are two other towns with longer name than llanfairpwllgwyngyllgogery chwyrndrobwllllantysiliogogogoch, one in New Zealand with 92 characters long, "Tetaumatawhakatang ihangakoauaotamateaurehaeaturipukap ihimaungahoronukupokaiwhenuaakitanarahu" and the other in Thailand which has a staggering 163 characters long named, "Krungthepmahanakornamornra tanakosinmahintarayutthayamahadilokph opnopparatrajathaniburiromudomrajaniwes mahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit".

It is easy to understand why the people living there burst into tears when you ask them where they are from.

No hay comentarios: