10 ago 2008
Children's day
The United Nations General Assembly recommended in 1954 (resolution 836(IX)) that all countries institute a Universal Children's Day, to be observed as a day of worldwide fraternity and understanding between children and of activity promoting the welfare of the world's children. It suggested to governments that the Day be observed on the date which each considers appropriate.
In Argentina Children's Day is celebrated on the second Sunday of August, TODAY!!!
HAPPY DAY CHILDREN!
7 ago 2008
Olympic Games
5 ago 2008
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
Llanfairpwllgwyngyllgogery chwyrndrobwllllantysiliogogogoch is the longest named railway station in the world. Llanfairpwllgwyngyllgo gerychwyrndrobwllllantysiliogogogoch is an actual town in Wales.Llanfairpwllgwyngyllgogerych wyrndrobwllllantysiliogogogoch, translated in English means "The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".
The locals hardly use this long word, instead call it as Llanfair.
Also, this town boasts the longest single word (without the hyphens) .com domain name in the world. The maximum allowed characters as a .com domain name is 67 characters in length. So this, Llanfairpwllgwyngyllgogery chwyrndrobwllllantysiliogogogoch.com has a few more characters to spare (58 characters in length). Llanfairpwllgwyngyllgogery chwyrndrobwllllantysiliogogogoch.com is officially in the Guinness Book of World Records and was registered by Internetters on 21st October 1999.
There are two other towns with longer name than llanfairpwllgwyngyllgogery chwyrndrobwllllantysiliogogogoch, one in New Zealand with 92 characters long, "Tetaumatawhakatang ihangakoauaotamateaurehaeaturipukap ihimaungahoronukupokaiwhenuaakitanarahu" and the other in Thailand which has a staggering 163 characters long named, "Krungthepmahanakornamornra tanakosinmahintarayutthayamahadilokph opnopparatrajathaniburiromudomrajaniwes mahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit".
It is easy to understand why the people living there burst into tears when you ask them where they are from.
Winter
Winter
Autumn winds are dying
As winter rears its head.
Soon the land will sleep again
In the silence of the dead.
The gray sky seems a blanket.
The golden trees now bare;
Their branches reach out to the sky
To grasp the misty air.
Dark browns replace the orange
And grays replace the blue
Soon snow will change this landscape
As the spiral dance holds true
The silence will be welcomed
By a solitary crow.
An eerie song of mystery
That few will ever know.
For winter keeps its secrets,
The ones not hard to hide.
The answer's all around us,
But the question sleeps inside.
Suscribirse a:
Entradas (Atom)