18 oct 2008

Mother's day

Everything I ever needed to know I learned from my mother:

My mother taught me TO APPRECIATE A JOB WELL DONE: "If you're going to kill each other, do it outside - I just finished cleaning!"
My mother taught me RELIGION: "You'd better pray that will como out of the carpet."
My mother taught me about TIME TRAVEL: "If you don't straighten up, I'm going to knock you into the middle of next week."
My mother taught me LOGIC: "Because I said so, that's why."
My mother taught me FORESIGHT: "Make sure you wear clean underwear, in case you're in an accident."
My mother taught me IRONY: "Keep crying and I'll give you something to cry about."
My mother taught me about the science of OSMOSIS: "Shut your mouth and eat your dinner."
My mother taught me about CONTORTIONISM: "Will you look at the dirt on the back of your neck."
My mother taught me about STAMINA: "YOu'll sit there 'till all that spinach is finished."
My mother taught me about WEATHER: "It looks as if a cyclone swept through your room."
My mother taught me about HYPOCRISY: "I've told you a million times - don't exaggerate!"
My mother taught me about THE CIRCLE OF LIFE: "I brought you into this world, and I can take you out."
My mother taught me about BEHAVIOUR MODIFICATION: "Stop acting like your father."
My mother taught me about ENVY: "There are millions of less fortunate children in this world who don't have a wonderful mother like you do!"

HAPPY MOTHER'S DAY!

10 oct 2008

Eric Grohe

There are some people who can make something extraordinary out of ordinary things. Eric Grohe is one of them. He paints murals and here is a token of his talent:




If you want to see more of his work click here http://www.ericgrohemurals.com

21 sept 2008

Happy Spring!

Spring
Robert McCracken

Today is the day when bold kites fly,
When cumulus clouds roar across the sky.
When robins return, when children cheer,
When light rain beckons spring to appear.

Today is the day when daffodils bloom,
Which children pick to fill the room,
Today is the day when grasses green,
When leaves burst forth for spring to be seen.


10 ago 2008

Children's day


The United Nations General Assembly recommended in 1954 (resolution 836(IX)) that all countries institute a Universal Children's Day, to be observed as a day of worldwide fraternity and understanding between children and of activity promoting the welfare of the world's children. It suggested to governments that the Day be observed on the date which each considers appropriate.

In Argentina Children's Day is celebrated on the second Sunday of August, TODAY!!!
HAPPY DAY CHILDREN!

7 ago 2008

Olympic Games


This is the link to the official website of the Beijing 2008 Olympic Games. Enjoy it!

http://en.beijing2008.cn/

5 ago 2008

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch


Llanfairpwllgwyngyllgogery chwyrndrobwllllantysiliogogogoch is the longest named railway station in the world. Llanfairpwllgwyngyllgo gerychwyrndrobwllllantysiliogogogoch is an actual town in Wales.Llanfairpwllgwyngyllgogerych wyrndrobwllllantysiliogogogoch, translated in English means "The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".
The locals hardly use this long word, instead call it as Llanfair.
Also, this town boasts the longest single word (without the hyphens) .com domain name in the world. The maximum allowed characters as a .com domain name is 67 characters in length. So this, Llanfairpwllgwyngyllgogery chwyrndrobwllllantysiliogogogoch.com has a few more characters to spare (58 characters in length). Llanfairpwllgwyngyllgogery chwyrndrobwllllantysiliogogogoch.com is officially in the Guinness Book of World Records and was registered by Internetters on 21st October 1999.

There are two other towns with longer name than llanfairpwllgwyngyllgogery chwyrndrobwllllantysiliogogogoch, one in New Zealand with 92 characters long, "Tetaumatawhakatang ihangakoauaotamateaurehaeaturipukap ihimaungahoronukupokaiwhenuaakitanarahu" and the other in Thailand which has a staggering 163 characters long named, "Krungthepmahanakornamornra tanakosinmahintarayutthayamahadilokph opnopparatrajathaniburiromudomrajaniwes mahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit".

It is easy to understand why the people living there burst into tears when you ask them where they are from.

Winter


Winter

Autumn winds are dying
As winter rears its head.
Soon the land will sleep again
In the silence of the dead.
The gray sky seems a blanket.
The golden trees now bare;
Their branches reach out to the sky
To grasp the misty air.

Dark browns replace the orange
And grays replace the blue
Soon snow will change this landscape
As the spiral dance holds true

The silence will be welcomed
By a solitary crow.
An eerie song of mystery
That few will ever know.

For winter keeps its secrets,
The ones not hard to hide.
The answer's all around us,
But the question sleeps inside.

20 jul 2008

Friend's day


Friend's Day is a celebration of friendship held annually on July 20th, mainly in Argentina and Uruguay but also in some other countries.

The idea for Friend's Day goes back to Argentine teacher, musician, and dentist Enrique Febbraro, who had the idea of turning the anniversary of the first moon landing into an international day of friendship. He argued that on this particular day, the whole world had been friends of the three astronauts. The first official recognition of the day came with decree No. 235/79 by the government of the province of Buenos Aires, which authorized the celebration and gave it official nature.

In Argentina, Friend's Day is often a good excuse for a common friendly gathering, though people also employ the day to get in contact with old and seldom-met friends and greet them. Since it is not a public holiday in Argentina, the gatherings tend to happen during the evening.

Though Friend's Day has always been respected, in recent years it has turned into a very popular mass phenomenon. In 2005, too many well-wishing friends led to a temporary breakdown of the mobile phone network in the cities of Buenos Aires, Córdoba and Rosario. In Rosario, the celebration of the Friends Day has been moved to the 19th of July, when Roberto Fontanarrosa, the best comic writer of the city, died.

Source: http://www.translatorscafe.com/cafe/MegaBBS/forumthread12038.htm

22 jun 2008

Mandela's words

While reading about Nelson Mandela, South Africa and the Apartheid last Friday, I found this quotation I'd like to share with you.

Mandela's statement from the dock in the Rivonia Trial ends with these words:

I have fought against white domination, and I have fought against black domination. I have cherished the ideal of a democratic and free society in which all persons live together in harmony and with equal opportunities. It is an ideal which I hope to live for and to achieve. But if needs be, it is an ideal for which I am prepared to die.

31 may 2008

Verb tense practice

Those of youwho want to practise with verb tenses should try this website. You can do exercises and get corrected on-line. Thank you Anto for the tip!
Good luck!

www.englishpage.com/verbpage/verbtenseintro.html